PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.K043500.1.p
Common NameSORBI_K043500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 286aa    MW: 29893.5 Da    PI: 9.3786
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.K043500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181863147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd ll ++v+q+G ++W++I++ ++ gR++k+c++rw + 
  Sobic.K043500.1.p 18 KGSWSPEEDALLTRLVEQHGAHRWSLISAAIP-GRSGKSCRLRWCNQ 63
                       799*****************************.***********985 PP

2Myb_DNA-binding55.61.2e-1772114347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++T+ Ed l++ a+ ++G++ W+tIar ++ gRt++++k++w++ 
  Sobic.K043500.1.p  72 PFTPHEDALILAAHSRYGNK-WATIARLLP-GRTDNSIKNHWNSN 114
                        89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4011368IPR017930Myb domain
SuperFamilySSF466891.46E-3115111IPR009057Homeodomain-like
SMARTSM007174.2E-171766IPR001005SANT/Myb domain
PfamPF002491.3E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-251971IPR009057Homeodomain-like
CDDcd001671.22E-152062No hitNo description
PROSITE profilePS5129419.15369119IPR017930Myb domain
SMARTSM007173.3E-1569117IPR001005SANT/Myb domain
CDDcd001671.11E-1272115No hitNo description
PfamPF002491.5E-1472114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2372117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKNPAPASSS SVAVEVKKGS WSPEEDALLT RLVEQHGAHR WSLISAAIPG RSGKSCRLRW  60
CNQLSPDVHH RPFTPHEDAL ILAAHSRYGN KWATIARLLP GRTDNSIKNH WNSNLRRCRR  120
RAAAAAAAAA SRAAAAAGPC IAIGPQQVQD SDDVVPPPAA AAESEHHHSP QQLVAVVAAA  180
GLGGGNSSVL PAGTATAEAE PSLSLSLGLP LPAEEPGAAA DEERRNSQQG HGQASPPVTL  240
QQGEGNAQLL AVVRQMVREE VQRQTGQLAY SLMAAAAAKA KGHHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-36151171103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9424851e-179EU942485.1 Zea mays clone 1509544 mRNA sequence.
GenBankKJ7275241e-179KJ727524.1 Zea mays clone pUT5383 MYB transcription factor (MYB127) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002489094.10.0hypothetical protein SORBIDRAFT_0088s002210
TrEMBLA0A120GUN50.0A0A120GUN5_SORBI; Uncharacterized protein
STRINGSb0088s002210.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-49myb domain protein 73